PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538948.1_FGP011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 374aa    MW: 40636 Da    PI: 9.0287
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538948.1_FGP011genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.88.9e-1794140148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  KN538948.1_FGP011  94 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 140
                        688*****************************.************996 PP

2Myb_DNA-binding54.33e-17146190147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +g WT+eEd +l++a++ + ++ W++Iar ++ gR+++ +k++w++ 
  KN538948.1_FGP011 146 KGIWTEEEDRKLIKAHQTYRNR-WSAIARSLP-GRSENTVKNHWNTT 190
                        678*******************.*********.************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.58189144IPR017930Myb domain
SuperFamilySSF466892.05E-2991187IPR009057Homeodomain-like
SMARTSM007172.8E-1693142IPR001005SANT/Myb domain
PfamPF002491.2E-1594140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2496144IPR009057Homeodomain-like
CDDcd001674.69E-1697140No hitNo description
PROSITE profilePS5129419.219145195IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-22145192IPR009057Homeodomain-like
SMARTSM007171.9E-16145193IPR001005SANT/Myb domain
PfamPF002491.7E-15146190IPR001005SANT/Myb domain
CDDcd001671.42E-14149191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MATDRMPDCH FMASSNGGAC YQNTRGTPIT MGVPNLGCLV ASIGMAPSSS LMPERGLVTA  60
NYNLVVGFPE DAAMVPQQQQ LQAAASSNNS GLIKGGWTRE EDEVLRQMVR HHGDRKWAEI  120
AKSLPGRIGK QCRERWTNHL HPDIKKGIWT EEEDRKLIKA HQTYRNRWSA IARSLPGRSE  180
NTVKNHWNTT KRSLSSKRRL RRKNSEQAVP GQPSLLEEFI RSCQHPLPNE TAPPASFDIG  240
GYGTGGTIGA SPTPPAVHAL GGSTPPGLVM FLDLLNQATP HPPQPDLNLL NITPVVPHLN  300
TSGYCLQLDA RGNLQYGQLP VQPHGISAQI GPSNVGTSGR TGGMDNNGVI QMASNQFVMP  360
SEDGGILDMA RWIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-40921965110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.10.0PREDICTED: transcription factor RAX1-like
TrEMBLA0A0E0Q6490.0A0A0E0Q649_ORYRU; Uncharacterized protein
STRINGBGIOSGA025449-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-43myb domain protein 98